PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0224s0160.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 677aa    MW: 73380.6 Da    PI: 6.9372
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0224s0160.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.13.5e-093744111954
                             HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  SapurV1A.0224s0160.3.p 374 FEHflHPYPKDSDKLMLAKQTGLTRSQVSNWFINARVR 411
                             554459******************************88 PP

2BELL126.11.3e-40238309172
                    BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                             erqe+q+kkakL+s+l+eV++rY+qy++q+q+vissFe++ag+gsak Yt+lAlk+iS++FrcLkdai++qi
  SapurV1A.0224s0160.3.p 238 ERQEIQMKKAKLISMLDEVEQRYRQYHHQMQIVISSFEQAAGIGSAKTYTALALKTISKQFRCLKDAITGQI 309
                             79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.2E-67162307IPR006563POX domain
PfamPF075262.1E-51167306IPR006563POX domain
PROSITE profilePS5007112.147352415IPR001356Homeobox domain
CDDcd000865.46E-12355416No hitNo description
SMARTSM003892.3E-9355419IPR001356Homeobox domain
SuperFamilySSF466898.13E-17356422IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-28358421IPR009057Homeodomain-like
PfamPF059206.1E-18372411IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    Send to blast
MATYFHGNPD FQAAAASAEG LQTLVLMNPT YVQYSNIPPP PPSNNLVFLN AAASNSLSAT  60
PHLSCHAPSN TQQFVGIPLD PNSHDSSTLH GLMPRIHYNL YNPIDPPPTA RDTPRAQQGL  120
SLSLSSQQQG CFGSQVQSVS GEDIRVSGGS VSSGSGVTNG VLGMQGVLLS SKYLKAAQEL  180
LDEVVSVNNN DIKSELSKKS NGISSNTSNK VAGGSLAGEG SGGGEASGKR GPELSTAERQ  240
EIQMKKAKLI SMLDEVEQRY RQYHHQMQIV ISSFEQAAGI GSAKTYTALA LKTISKQFRC  300
LKDAITGQIK ASNKSLGEED CLGEKIEGSR LKFVDHHLRQ QRALQQLGMI QHNAWRPQRG  360
LPERSVSVLR AWLFEHFLHP YPKDSDKLML AKQTGLTRSQ VSNWFINARV RLWKPMVEEM  420
YTEEIKEQEQ DGSEDKTSKS DHNEDSASRS ALQEKGSAGE NQTRSFKSLD NSPDAPSAIS  480
LPAASTSPVG GNVRNQSGFS FIGSSELEGI TQRSPKKPRS NDFIQSSSSV PSINMDIKPG  540
HEANNEQVSL KFGSERQSRD GYSFMGGQTN FIGGFGQYPI GEIGRFDGEQ FTPRFSGNGV  600
SLSLGLPHCE NLSLSGTHQT FLPNHDIQLG RRVEIGEPNE FGSINTSAPH SSTAYENIDI  660
QNGKRFIAQL LPDFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B2e-16361418158Homeobox protein Meis1
4xrs_A2e-16361418158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT0288670.0CT028867.1 Poplar cDNA sequences.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006373820.10.0hypothetical protein POPTR_0016s07040g
RefseqXP_002323384.20.0hypothetical protein POPTR_0016s07040g
RefseqXP_006373821.10.0BEL1-like homeodomain 1 family protein
RefseqXP_006373822.10.0hypothetical protein POPTR_0016s07040g
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLB9IIL10.0B9IIL1_POPTR; BEL1-like homeodomain 1 family protein
STRINGPOPTR_0016s07040.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-167BEL1-like homeodomain 1